ROIDS PEPTIDE LAB
Sermorelin Acetate 5mg
BUY Growth hormones

Sermorelin Acetate 5mg

4.5
(70 reviews)

Sermorelin Acetate 5mg Endocrine Research with High-Purity Sermorelin Acetate 5MG High-purity Sermorelin Acetate (5mg) in lyophilised form, water-soluble and ideal for hormone-related research.

$30.33

✓ In Stock

Explore Endocrine Research with High-Purity Sermorelin Acetate – 5mg

Sermorelin Acetate is a synthetic peptide analogue of growth hormone–releasing hormone (GHRH), designed for advanced research into pituitary function, hormone signaling, and endocrine regulation. With a purity of ≥98%, this peptide provides consistent reliability for high-level laboratory investigations.

✅ ≥98% Purity – Research Grade
🔬 Designed for Endocrinology and Hormonal Pathway Studies
🧪 Precision-Manufactured Lyophilised Peptide

Product Details:
• Name: Sermorelin Acetate
• Quantity: 5mg
• Catalogue Number: UKSERM2
• Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
• Molecular Weight: 3358.9 g/mol
• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂ (acetate salt)
• Form: Lyophilised Solid

Storage & Handling:
Sermorelin Acetate is supplied as a stable lyophilised powder to maintain integrity and maximize shelf life. Please consult our detailed guidelines for reconstitution and storage.

Note: This product is strictly for laboratory research use only. Not for human consumption or clinical application.

You May Also Like

View all
Growth Hormone (Somatropin) 100 iu / 33,3 mg
Quick View
BUY Growth hormones In Stock

Growth Hormone (Somatropin) 100 iu / 33,3 mg

4.5
(67 reviews)

Categories: Androchem, GROWTH HORMONE, Others Tags: gh, Growrth hormone, growth hormone, hgh

Price
$ 175.00
Frag GH 176-191, 5mg vial
Quick View
BUY Growth hormones In Stock

Frag GH 176-191, 5mg vial

3.8
(54 reviews)

Categories: Androchem, Fat burners, GROWTH HORMONE, Others, Peptides & SARMs

Price
$ 26.00
Growth Hormone BALTIC 100 jednostek
Quick View
BUY Growth hormones In Stock

Growth Hormone BALTIC 100 jednostek

4.8
(68 reviews)

Categories: GROWTH HORMONE, Others, Pharma Grade Tags: gh, growth hormone, growth hormone

Price
$ 160.00

Discreet delivery for peace of mind

After authorization is confirmed, orders are processed and prepared for dispatch within 24-48 hours by our team.
All packages are shipped in plain, unmarked outer packaging to ensure complete privacy and security.
Choose from trusted carriers offering fully tracked, rapid delivery to your location.
Buy Now
Feature Illustration